PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00014182001
Common NameGSBRNA2T00014182001, LOC106347748
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 335aa    MW: 37453.8 Da    PI: 5.3461
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00014182001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94e-32193248156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++WtpeLH+rFv+a++qLGG+ +AtPk+i+e+m+ +gLt+++vkSHLQkYRl+
  GSBRNA2T00014182001 193 KQRRCWTPELHRRFVDALQQLGGPGVATPKQIREHMQEEGLTNDEVKSHLQKYRLH 248
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.122190250IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-28191251IPR009057Homeodomain-like
SuperFamilySSF466897.26E-18191251IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-26193248IPR006447Myb domain, plants
PfamPF002493.1E-9195246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGSLGDELSL GSRRHCSMPT TIYGFPTNPS KITNVKKLEE EKMKIQGSDL ELPLCLQILN  60
DAISCLKEES KRCSEMDTQP LSKDFISGDG PLLKREEKKL LQLWREDDHI SNGRFSDTNN  120
KLDDIEINEE KPSNGLSMLL KTPEVETGLG LGLASSSMFN GGRRKETASC GFTSNVSVPQ  180
PPPYLQQQEL SRKQRRCWTP ELHRRFVDAL QQLGGPGVAT PKQIREHMQE EGLTNDEVKS  240
HLQKYRLHIR KSNSNPEKQS VLVLGFNLWN SSSKEEEEET GEGRESSKRN NSQSDSPQGP  300
LHLPCTTTTT TTGGDSCMED AEDAKSESFQ IWRD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013642794.10.0PREDICTED: two-component response regulator-like APRR2
TrEMBLA0A078K0B00.0A0A078K0B0_BRANA; BnaCnng72430D protein
STRINGBra018794.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139271824
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.12e-93G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]